Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
Pancreatic Polypeptide (rana temporaria)
Catalogue# Size Purity Price Order
 P100448-0001  1mg  95%  £149.60  
M.W.      4,240.65 
Sequence
(one letter code)     
APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF-NH2 
Sequence
(three letter code)     
Ala-Pro-Ser-Glu-Pro-His-His-Pro-Gly-Asp-Gln-Ala-Thr-Gln-Asp-Gln-Leu-Ala-Gln-Tyr-Tyr-Ser-Asp-Leu-Tyr-Gln-Tyr-Ile-Thr-Phe-Val-Thr-Arg-Pro-Arg-Phe-NH2 
Formula      C192H276N52O58 
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.