Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides H >>
 
Product Catalogue # Size Price Order
HIV-gp120-Fragment (254-274)
CTHGIRPVVSTQLLLNGSLAE
 H89133-0001  1mg  £63.80  
 H89133-0005  5mg  £191.40  
 H89133-0010  10mg  £319.00  
HIV-gp120-Fragment (308-331)
NNTRKSIRIQRGPGRAFVTIGKIG
 H89134-0001  1mg  £72.60  
 H89134-0005  5mg  £217.80  
 H89134-0010  10mg  £363.00  
HIV-gp120-Fragment (318-327)
RGPGRAFVTI
 H53934-0005  5mg  £92.40  
 H53934-0010  10mg  £154.00  
 H53934-0025  25mg  £308.00  
HIV-gp120-Fragment (421-438)
KQFINMWQEVGKAMYAPP
 H89135-0001  1mg  £55.00  
 H89135-0005  5mg  £165.00  
 H89135-0010  10mg  £275.00  
HIV-gp41-Antigenic Peptide 5
RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2 (Disulfide bridge: Cys20-Cys26)
 H89138-0001  1mg  £158.40  
 H89138-0005  5mg  £475.20  
 H89138-0010  10mg  £792.00  
HIV-gp41-Fragment
AVGIGA
 H89137-0005  5mg  £56.10  
 H89137-0010  10mg  £93.50  
 H89137-0025  25mg  £187.00  
IV9 (476-484), HIV-1 RT Epitope
ILKEPVHGV
 H51786-0005  5mg  £82.50  
 H51786-0010  10mg  £137.50  
 H51786-0025  25mg  £275.00  
SIVmac239-1
MGVRNSVLSGKKADE
 H55147-0002  2mg  £59.40  
 H55147-0005  5mg  £105.60  
 H55147-0010  10mg  £165.00  
 
Total 3 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2023 Designer BioScience Ltd. All rights reserved.