Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides N >>
 
Product Catalogue # Size Price Order
Prepro-Neuromedin S (70-103) (human)
FLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLAN
 N100036-0001  1mg  £103.40  
 N100036-0005  5mg  £310.20  
 N100036-0010  10mg  £517.00  
Prepro-Neuromedin U (104-136) (human)
FLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHE
 N100039-0001  1mg  £100.10  
 N100039-0005  5mg  £300.30  
 N100039-0010  10mg  £500.50  
 
Total 4 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2025 Designer BioScience Ltd. All rights reserved.