Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides E >> Exendins and Fragments
 
Product Catalogue # Size Price Order
Biotin-Exendin 4
Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
 E100814-0001  1mg  £113.30  
 E100814-0005  5mg  £339.90  
 E100814-0010  10mg  £566.50  
Exendin (9-39)
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
 E55285-0001  1mg  £97.90  
 E55285-0005  5mg  £293.70  
 E55285-0010  10mg  £489.50  
Exendin 3
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
 E55409-0001  1mg  £162.80  
 E55409-0005  5mg  £488.40  
 E55409-0010  10mg  £814.00  
Exendin 4
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
 E52143-0001  1mg  £162.80  
 E52143-0005  5mg  £488.40  
 E52143-0010  10mg  £814.00  
Exendin 4 (1-39)
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
 E87196-0001  1mg  £115.50  
 E87196-0005  5mg  £346.50  
 E87196-0010  10mg  £577.50  
Exendin 4 (1-8)
HGEGTFTS-NH2
 E100297-0005  5mg  £82.50  
 E100297-0010  10mg  £137.50  
 E100297-0025  25mg  £275.00  
Exendin 4 (3-39)
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
 E101099-0001  1mg  £110.00  
 E101099-0005  5mg  £330.00  
 E101099-0010  10mg  £550.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2020 Designer BioScience Ltd. All rights reserved.