Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides G >> Gastric Inhibitory Polypeptides and Fragments
 
Product Catalogue # Size Price Order
[Tyr0] Gastric Inhibitory Peptide (23-42), human; [Tyr22]Gastric Inhibitory Peptide (22-42), human
YVNWLLAQKGKKNDWKHNITQ
 G101812-0001  1mg  £63.80  
 G101812-0005  5mg  £191.40  
 G101812-0010  10mg  £319.00  
Gastric Inhibitory Peptide(GIP), human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
 G55416-00005  0.5mg  £83.60  
 G55416-0001  1mg  £141.90  
 G55416-00025  2.5mg  £250.80  
Gastric Inhibitory Polypeptide(1-30) (porcine)
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
 G101816-0001  1mg  £91.30  
 G101816-0005  5mg  £273.90  
 G101816-0010  10mg  £456.50  
Gastric Inhibitory Polypeptide(6-30) amide (human)
FISDYSIAMDKIHQQDFVNWLLAQK-NH2
 G100253-0001  1mg  £79.20  
 G100253-0005  5mg  £237.60  
 G100253-0010  10mg  £396.00  
Gastric Juice Peptide Fragmentc
GEPPPGKPADDAGLV
 G76014-0001  1mg  £45.10  
 G76014-0005  5mg  £135.30  
 G76014-0010  10mg  £225.50  
GIP (1-30) porcine amide;Gastric Inhibitory Polypeptide (1-30) amide (porcine); GIP (1-30) amide (porcine); Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine)
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
 M88136-0001  1mg  £125.40  
 M88136-0005  5mg  £376.20  
 M88136-0010  10mg  £627.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2025 Designer BioScience Ltd. All rights reserved.