Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides I >> Intermedins
 
Product Catalogue # Size Price Order
Biotin-Intermedin (human)
Biotin-TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2
 I89205-0001  1mg  £113.30  
 I89205-0005  5mg  £339.90  
 I89205-0010  10mg  £566.50  
Biotin-Intermedin (rat)
Biotin-PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2
 I89207-0001  1mg  £113.30  
 I89207-0005  5mg  £339.90  
 I89207-0010  10mg  £566.50  
Intermedin (human)
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2
 I54832-0001  1mg  £194.70  
 I54832-0005  5mg  £584.10  
 I54832-0010  10mg  £973.50  
Intermedin (rat)
PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2
 I89206-0001  1mg  £194.70  
 I89206-0005  5mg  £584.10  
 I89206-0010  10mg  £973.50  
Intermedin-53 (human)
HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2
 I89208-0001  1mg  £218.90  
 I89208-0005  5mg  £656.70  
 I89208-0010  10mg  £1,094.50  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2021 Designer BioScience Ltd. All rights reserved.