Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides L >> LL-37 and Fragments
 
Product Catalogue # Size Price Order
LL-37 pentamide
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
 L88324-0001  1mg  £149.60  
 L88324-0005  5mg  £448.80  
 L88324-0010  10mg  £748.00  
LL-37, Antimicrobial Peptide, human
[LL-37, 37 aa]
 L54949-0001  1mg  £149.60  
 L54949-0005  5mg  £448.80  
 L54949-0010  10mg  £748.00  
LL-37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
 L88325-0001  1mg  £149.60  
 L88325-0005  5mg  £448.80  
 L88325-0010  10mg  £748.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2025 Designer BioScience Ltd. All rights reserved.