Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides P >> Peptide YY and Related Peptides
 
Product Catalogue # Size Price Order
[Leu31, Pro34]-Peptide YY(human)
YPIKPEAPGEDASPEELNRYYASLRHYLNLLTRPRY-NH2
 P100451-0001  1mg  £149.60  
 P100451-0005  5mg  £448.80  
 P100451-0010  10mg  £748.00  
[Pro34]-Peptide YY (human); [Pro34]-PYY (human)
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRPRY-NH2
 P87475-0001  1mg  £149.60  
 P87475-0005  5mg  £448.80  
 P87475-0010  10mg  £748.00  
Peptide YY (13-36) (canine, mouse, porcine, rat)
SPEELSRYYASLRHYLNLVTRQRY-NH2
 P100453-0001  1mg  £75.90  
 P100453-0005  5mg  £227.70  
 P100453-0010  10mg  £379.50  
Peptide YY (3-36) (canine, mouse, porcine, rat)
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
 P100452-0001  1mg  £141.90  
 P100452-0005  5mg  £425.70  
 P100452-0010  10mg  £709.50  
Peptide YY (canine, mouse,porcine, rat)
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
 P52297-0001  1mg  £149.60  
 P52297-0005  5mg  £448.80  
 P52297-0010  10mg  £748.00  
Peptide YY(3-36), PYY, human
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
 P55293-0001  1mg  £141.90  
 P55293-0005  5mg  £425.70  
 P55293-0010  10mg  £709.50  
Peptide YY, Human
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
 P52296-0001  1mg  £149.60  
 P52296-0005  5mg  £448.80  
 P52296-0010  10mg  £748.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2022 Designer BioScience Ltd. All rights reserved.