Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides P >> Pituitary Adenylate Cyclase Activating Polypeptides (PACAP) and Fragments
 
Product Catalogue # Size Price Order
[Arg14, 20, 21, Leu16]-PACAP(1-27), amide, human, ovine, rat
HSDGIFTDSYSRYRRQLAVRRYLAAVL-NH2
 P101262-0001  1mg  £113.30  
 P101262-0005  5mg  £339.90  
 P101262-0010  10mg  £566.50  
[Arg14, 20, 21, Leu16]-PACAP(1-27)-Gly-Lys-Arg, amide, human, ovine, rat
HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2
 P101260-0001  1mg  £125.40  
 P101260-0005  5mg  £376.20  
 P101260-0010  10mg  £627.00  
[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat
FTDSYSRYRKMAVKKYLAAVL-NH2
 P101264-0001  1mg  £67.10  
 P101264-0005  5mg  £201.30  
 P101264-0010  10mg  £335.50  
Ac-PACAP-38 (human, mouse, ovine, porcine, rat)
Ac-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
 P100455-0001  1mg  £162.80  
 P100455-0005  5mg  £488.40  
 P100455-0010  10mg  £814.00  
Biotin-PACAP (1-38), amide, human, ovine, rat
Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
 P101261-0001  1mg  £117.70  
 P101261-0005  5mg  £353.10  
 P101261-0010  10mg  £577.50  
PACAP (1-38), human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
 P52290-00005  0.5mg  £136.40  
 P52290-0001  1mg  £232.10  
 P52290-00025  2.5mg  £409.20  
PACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK{Lys(Biotin)}-NH2
 P101263-00005  0.5mg  £201.30  
 P101263-0001  1mg  £341.00  
 P101263-00025  2.5mg  £602.80  
PACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
FTDSYSRYRKQMAVKKYLAAVL-NH2
 P55221-0001  1mg  £70.40  
 P55221-0005  5mg  £211.20  
 P55221-0010  10mg  £352.00  
PACAP-27 (human, mouse, ovine, porcine, rat)
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
 P55231-0001  1mg  £84.70  
 P55231-0005  5mg  £254.10  
 P55231-0010  10mg  £423.50  
PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat)
QMAVKKYLAAVLGKRYKQRVKNK-NH2
 P100456-0001  1mg  £72.60  
 P100456-0005  5mg  £217.80  
 P100456-0010  10mg  £363.00  
 
Total 2 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2022 Designer BioScience Ltd. All rights reserved.