Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides P >> pTH-Related Protein Sequences
 
Product Catalogue # Size Price Order
[Asn10,Leu11,D-Trp12]-pTH Related Protein (7-34) amide (human, rat);(Asn10,Leu11,D-Trp12)-Hypercalcemia of Malignancy Factor (7-34) amide (human, mouse, rat)
LLHNL{D-Trp}KSIQDLRRRFFLHHLIAEIHTA-NH2
 P101862-0001  1mg  £84.70  
 P101862-0005  5mg  £254.10  
 P101862-0010  10mg  £423.50  
[Tyr0]-pTH-Related Protein (1-40) (human, mouse, rat);[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATS
 P101257-0001  1mg  £166.10  
 P101257-0005  5mg  £498.30  
 P101257-0010  10mg  £830.50  
[Tyr36]-pTH-Related Protein (1-36) (human, mouse, rat);(Tyr36)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
 P101861-0001  1mg  £146.30  
 P101861-0005  5mg  £438.90  
 P101861-0010  10mg  £731.50  
pTH (28-48) (human)
LQDVHNFVALGAPLAPRDAGS
 P101877-0001  1mg  £63.80  
 P101877-0005  5mg  £191.40  
 P101877-0010  10mg  £319.00  
pTH (53-84) (human)
KKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
 P101941-0001  1mg  £129.80  
 P101941-0005  5mg  £389.40  
 P101941-0010  10mg  £649.00  
pTH (70-84) (human);Parathyroid Hormone (70-84) (human)
ADKADVNVLTKAKSQ
 P101945-0001  1mg  £45.10  
 P101945-0005  5mg  £135.30  
 P101945-0010  10mg  £225.50  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2022 Designer BioScience Ltd. All rights reserved.