Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides U >> Urotensin and Analogs
 
Product Catalogue # Size Price Order
Urotensin I
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
 U55414-0001  1mg  £213.40  
 U55414-0005  5mg  £640.20  
 U55414-0010  10mg  £1,067.00  
Urotensin II (Frog)
AGNLSECFWKYCV-OH(Disulfide bridge: Cys7-Cys12)
 U55272-00005  0.5mg  £74.80  
 U55272-0001  1mg  £127.60  
 U55272-00025  2.5mg  £224.40  
Urotensin II , goby
AGTADCFWKYCV(Disulfide bridge: Cys6-Cys11)
 U87352-0001  1mg  £49.50  
 U87352-0005  5mg  £148.50  
 U87352-0010  10mg  £247.50  
Urotensin II , human
ETPDCFWKYCV(Disulfide bridge: Cys5-Cys10)
 U55270-00005  0.5mg  £74.80  
 U55270-0001  1mg  £127.60  
 U55270-00025  2.5mg  £224.40  
Urotensin II, rat; [Pyr110]-Prepro-Urotensin II (110-123), rat
{Glp}HGTAPECFWKYCI(Disulfide bridge: Cys8-Cys13)
 U101336-00005  0.5mg  £84.70  
 U101336-0001  1mg  £144.10  
 U101336-00025  2.5mg  £253.00  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2021 Designer BioScience Ltd. All rights reserved.