Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides C >> C-Type Natriuretic Peptides (CNP)
 
Product Catalogue # Size Price Order
[Tyr0]-C-Type Natriuretic Peptide (32-53) (human,porcine, rat)
YGLSKGCFGLKLDRIGSMSGLG (Disulfide bridge: Cys 7-Cys 23)
 C89550-0001  1mg  £75.90  
 C89550-0005  5mg  £260.70  
 C89550-0010  10mg  £401.50  
C-Type Natriuretic Peptide (1-22),human
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: Cys6-Cys22)
 C52233-00005  0.5mg  £79.20  
 C52233-0001  1mg  £134.20  
 C52233-00025  2.5mg  £237.60  
C-Type Natriuretic Peptide (1-53) (human)
DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: Cys37-Cys54)
 C89549-00005  0.5mg  £237.60  
 C89549-0001  1mg  £402.60  
 C89549-00025  2.5mg  £712.80  
C-Type Natriuretic Peptide,Chicken
GLSRSCFGVKLDRIGSMSGLGC (Disulfide bridge: Cys6-Cys22)
 C55271-00005  0.5mg  £74.80  
 C55271-0001  1mg  £127.60  
 C55271-00025  2.5mg  £224.40  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2025 Designer BioScience Ltd. All rights reserved.