Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
[Des-His1, Glu9]-Glucagon(1-29)amide (human, bovine, porcine)
Catalogue# Size Purity Price Order
 G82512-0010  10mg  95%  £440.00  
M.W.      3358.71 
CAS    110084-95-2 
Sequence
(one letter code)     
SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2 
Sequence
(three letter code)     
Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2 
Formula      C148H221N41O47
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2025 Designer BioScience Ltd. All rights reserved.