|
|
|
| [Thr30]-Neuropeptide Y, human |
| Catalogue# |
Size |
Purity |
Price |
Order |
| N101117-0001 |
1mg |
95% |
£149.60 |
 |
| M.W. |
4,259.73 |
Sequence (one letter code) |
YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2 |
Sequence (three letter code) |
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Thr-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Formula |
C187H281N55O58S |
| Storage | Longterm storage temperature: -20 ± 5 °C |
| |
|
| |
|