Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides >>
Prepro-Atrial Natriuretic Factor (26-55) (human); Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human)
Catalogue# Size Purity Price Order
 A100531-0001  1mg  95%  £122.10  
M.W.      3507.98 
CAS    112160-82-4 
Sequence
(one letter code)     
NPMYNAVSNADLMDFKNLLDHLEEKMPLED 
Sequence
(three letter code)     
Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp 
Formula      C152H236N38O51S3 
Storage  Longterm storage temperature: -20 ± 5 °C  
 
 
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2025 Designer BioScience Ltd. All rights reserved.