Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides P >> Pancreatic Polypeptides
 
Product Catalogue # Size Price Order
[Gly1, Ser3, 22, Gln4, 34, Thr6, Ala19, Tyr21, Ala23, 31, Aib32]-Pancreatic Polypeptide(human)
GPSQPTYPGDNATPEQMARYYSALRRYINMA{Aib}RQRY-NH2
 P100447-0001  1mg  £149.60  
 P100447-0005  5mg  £448.80  
 P100447-0010  10mg  £748.00  
Biotin-Pancreatic Polypeptide, human
Biotin-APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
 P101126-0001  1mg  £113.30  
 P101126-0005  5mg  £339.90  
 P101126-0010  10mg  £566.50  
Pancreatic Polypeptide (1-17)-(Ala31, Aib32)-Neuropeptide Y(18-36) (human)
APLEPVYPGDNATPEQMARYYSALRHYINLA{Aib}RQRY-NH2
 P100074-0001  1mg  £149.60  
 P100074-0005  5mg  £448.80  
 P100074-0010  10mg  £748.00  
Pancreatic Polypeptide (31-36)(free acid) (human)
LTRPRY
 P100450-0005  5mg  £56.10  
 P100450-0010  10mg  £93.50  
 P100450-0025  25mg  £187.00  
Pancreatic Polypeptide (31-36)(human)
LTRPRY-NH2
 P100449-0005  5mg  £62.70  
 P100449-0010  10mg  £104.50  
 P100449-0025  25mg  £209.00  
Pancreatic Polypeptide (rana temporaria)
APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF-NH2
 P100448-0001  1mg  £149.60  
 P100448-0005  5mg  £448.80  
 P100448-0010  10mg  £748.00  
Pancreatic Polypeptide(bovine)
APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY-NH2
 P100446-0001  1mg  £149.60  
 P100446-0005  5mg  £448.80  
 P100446-0010  10mg  £748.00  
Pancreatic Polypeptide, avian
GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2
 P55301-0001  1mg  £171.60  
 P55301-0002  2mg  £303.60  
 P55301-0500  0.5mg  £101.20  
Pancreatic Polypeptide, rat
APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2
 P52291-0001  1mg  £149.60  
 P52291-0005  5mg  £448.80  
 P52291-0010  10mg  £748.00  
Pancreatic Polypeptide,human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
 P52293-0001  1mg  £146.30  
 P52293-0005  5mg  £438.90  
 P52293-0010  10mg  £731.50  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2022 Designer BioScience Ltd. All rights reserved.